C1orf57 (NTPCR) (NM_032324) Human Mass Spec Standard
CAT#: PH303017
C1orf57 MS Standard C13 and N15-labeled recombinant protein (NP_115700)
View other "C1orf57" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C1orf57 MS Standard C13 and N15-labeled recombinant protein (NP_115700) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203017 |
| Predicted MW | 20.7 kDa |
| Protein Sequence |
>RC203017 protein sequence
Red=Cloning site Green=Tags(s) MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPP PGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTII LGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115700 |
| RefSeq Size | 926 |
| RefSeq ORF | 570 |
| Synonyms | C1orf57; HCR-NTPase; THEP1 |
| Locus ID | 84284 |
| Cytogenetics | 1q42.2 |
| Summary | The protein encoded by this gene is a non-specific nucleoside triphosphatase that is slow-acting in vitro. This gene is overexpressed in many tumor tissues, and while it is not essential for the cell, overexpression is cytotoxic. However, the cytotoxicity is not related to its triphosphatase activity. [provided by RefSeq, Jul 2016] |
| Protein Families | Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410200 | NTPCR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410200 | Transient overexpression lysate of chromosome 1 open reading frame 57 (C1orf57) |
CNY 3080.00 |
|
| TP303017 | Recombinant protein of human chromosome 1 open reading frame 57 (C1orf57), 20 µg |
CNY 2900.00 |
其它C1orf57产品
