PLTP (NM_182676) Human Recombinant Protein
CAT#: TP302925
Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 2, 20 µg
View other "PLTP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202925 protein sequence
Red=Cloning site Green=Tags(s) MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYHAG TVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEER MVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAP PRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSAL ESLALIPLQAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVI EKNRPADVRASTAPTPSTAAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_872617 |
| Locus ID | 5360 |
| UniProt ID | P55058 |
| Refseq Size | 1944 |
| Cytogenetics | 20q13.12 |
| Refseq ORF | 1323 |
| Synonyms | BPIFE; HDLCQ9 |
| Summary | The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401875 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405442 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401875 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 1 |
CNY 3080.00 |
|
| LY405442 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 2 |
CNY 3080.00 |
|
| PH302925 | PLTP MS Standard C13 and N15-labeled recombinant protein (NP_872617) |
CNY 19520.00 |
|
| PH305797 | PLTP MS Standard C13 and N15-labeled recombinant protein (NP_006218) |
CNY 19520.00 |
|
| TP305797 | Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 1, 20 µg |
CNY 2900.00 |
