PLTP (NM_182676) Human Mass Spec Standard
CAT#: PH302925
PLTP MS Standard C13 and N15-labeled recombinant protein (NP_872617)
View other "PLTP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PLTP MS Standard C13 and N15-labeled recombinant protein (NP_872617) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202925 |
| Predicted MW | 49.3 kDa |
| Protein Sequence |
>RC202925 protein sequence
Red=Cloning site Green=Tags(s) MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKV TELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYHAG TVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEER MVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAP PRCTIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSAL ESLALIPLQAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVI EKNRPADVRASTAPTPSTAAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872617 |
| RefSeq Size | 1944 |
| RefSeq ORF | 1323 |
| Synonyms | BPIFE; HDLCQ9 |
| Locus ID | 5360 |
| Cytogenetics | 20q13.12 |
| Summary | The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401875 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405442 | PLTP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401875 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 1 |
CNY 3080.00 |
|
| LY405442 | Transient overexpression lysate of phospholipid transfer protein (PLTP), transcript variant 2 |
CNY 3080.00 |
|
| PH305797 | PLTP MS Standard C13 and N15-labeled recombinant protein (NP_006218) |
CNY 19520.00 |
|
| TP302925 | Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP305797 | Recombinant protein of human phospholipid transfer protein (PLTP), transcript variant 1, 20 µg |
CNY 2900.00 |
