NENF (NM_013349) Human Recombinant Protein
CAT#: TP302850
Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1, 20 µg
View other "NENF" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s) MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037481 |
Locus ID | 29937 |
UniProt ID | Q9UMX5 |
Refseq Size | 944 |
Cytogenetics | 1q32.3 |
Refseq ORF | 516 |
Synonyms | CIR2; SCIRP10; SPUF |
Summary | This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415653 | NENF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415653 | Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 |
CNY 3080.00 |
|
PH302850 | NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481) |
CNY 19520.00 |
|
TP701036 | Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |