NENF (NM_013349) Human Mass Spec Standard
CAT#: PH302850
NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481)
View other "NENF" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202850 |
Predicted MW | 18.86 kDa |
Protein Sequence |
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s) MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037481 |
RefSeq Size | 944 |
RefSeq ORF | 516 |
Synonyms | CIR2; SCIRP10; SPUF |
Locus ID | 29937 |
Cytogenetics | 1q32.3 |
Summary | This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415653 | NENF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415653 | Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 |
CNY 3080.00 |
|
TP302850 | Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP701036 | Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |