DNAL1 (NM_031427) Human Recombinant Protein
CAT#: TP302768
Recombinant protein of human dynein, axonemal, light chain 1 (DNAL1), 20 µg
View other "DNAL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202768 protein sequence
Red=Cloning site Green=Tags(s) MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLK GIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGT PVIKGDEEEDN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_113615 |
| Locus ID | 83544 |
| UniProt ID | Q4LDG9 |
| Refseq Size | 8538 |
| Cytogenetics | 14q24.3 |
| Refseq ORF | 453 |
| Synonyms | C14orf168; CILD16; LC1 |
| Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
| Protein Pathways | Huntington's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410537 | DNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410537 | Transient overexpression lysate of dynein, axonemal, light chain 1 (DNAL1) |
CNY 3080.00 |
|
| PH302768 | DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615) |
CNY 19520.00 |
