DNAL1 (NM_031427) Human Mass Spec Standard
CAT#: PH302768
DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615)
View other "DNAL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202768 |
| Predicted MW | 17.1 kDa |
| Protein Sequence |
>RC202768 protein sequence
Red=Cloning site Green=Tags(s) MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLK GIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGT PVIKGDEEEDN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_113615 |
| RefSeq Size | 8538 |
| RefSeq ORF | 453 |
| Synonyms | C14orf168; CILD16; LC1 |
| Locus ID | 83544 |
| Cytogenetics | 14q24.3 |
| Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
| Protein Pathways | Huntington's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410537 | DNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410537 | Transient overexpression lysate of dynein, axonemal, light chain 1 (DNAL1) |
CNY 3080.00 |
|
| TP302768 | Recombinant protein of human dynein, axonemal, light chain 1 (DNAL1), 20 µg |
CNY 2900.00 |
