HSD17B14 (NM_016246) Human Recombinant Protein
CAT#: TP302531
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14), 20 µg
View other "HSD17B14" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202531 protein sequence
Red=Cloning site Green=Tags(s) MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057330 |
Locus ID | 51171 |
UniProt ID | Q9BPX1 |
Refseq Size | 1277 |
Cytogenetics | 19q13.33 |
Refseq ORF | 810 |
Synonyms | DHRS10; retSDR3; SDR47C1 |
Summary | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414089 | HSD17B14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414089 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 14 (HSD17B14) |
CNY 3080.00 |
|
PH302531 | HSD17B14 MS Standard C13 and N15-labeled recombinant protein (NP_057330) |
CNY 19520.00 |
其它HSD17B14产品