Gemin 6 (GEMIN6) (NM_024775) Human Recombinant Protein
CAT#: TP302296
Recombinant protein of human gem (nuclear organelle) associated protein 6 (GEMIN6), 20 µg
View other "Gemin 6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202296 protein sequence
Red=Cloning site Green=Tags(s) MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD PENCSSSNEIILSRVQDLIEGHLTASQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079051 |
| Locus ID | 79833 |
| UniProt ID | Q8WXD5 |
| Refseq Size | 705 |
| Cytogenetics | 2p22.1 |
| Refseq ORF | 501 |
| Summary | GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM, Jul 2002] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411066 | GEMIN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411066 | Transient overexpression lysate of gem (nuclear organelle) associated protein 6 (GEMIN6) |
CNY 3080.00 |
|
| PH302296 | GEMIN6 MS Standard C13 and N15-labeled recombinant protein (NP_079051) |
CNY 19520.00 |
其它Gemin 6产品
