Gemin 6 (GEMIN6) (NM_024775) Human Mass Spec Standard
CAT#: PH302296
GEMIN6 MS Standard C13 and N15-labeled recombinant protein (NP_079051)
View other "Gemin 6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GEMIN6 MS Standard C13 and N15-labeled recombinant protein (NP_079051) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202296 |
| Predicted MW | 18.9 kDa |
| Protein Sequence |
>RC202296 protein sequence
Red=Cloning site Green=Tags(s) MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD PENCSSSNEIILSRVQDLIEGHLTASQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079051 |
| RefSeq Size | 705 |
| RefSeq ORF | 501 |
| Locus ID | 79833 |
| Cytogenetics | 2p22.1 |
| Summary | GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM, Jul 2002] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411066 | GEMIN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411066 | Transient overexpression lysate of gem (nuclear organelle) associated protein 6 (GEMIN6) |
CNY 3080.00 |
|
| TP302296 | Recombinant protein of human gem (nuclear organelle) associated protein 6 (GEMIN6), 20 µg |
CNY 2900.00 |
其它Gemin 6产品
