GNG11 (NM_004126) Human Recombinant Protein
CAT#: TP302169
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 11 (GNG11), 20 µg
View other "GNG11" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202169 protein sequence
Red=Cloning site Green=Tags(s) MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC VIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004117 |
Locus ID | 2791 |
UniProt ID | P61952 |
Refseq Size | 964 |
Cytogenetics | 7q21.3 |
Refseq ORF | 219 |
Synonyms | GNGT11 |
Summary | This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418201 | GNG11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418201 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 11 (GNG11) |
CNY 3080.00 |
|
PH302169 | GNG11 MS Standard C13 and N15-labeled recombinant protein (NP_004117) |
CNY 19520.00 |