GNG11 (NM_004126) Human Mass Spec Standard
CAT#: PH302169
GNG11 MS Standard C13 and N15-labeled recombinant protein (NP_004117)
View other "GNG11" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | GNG11 MS Standard C13 and N15-labeled recombinant protein (NP_004117) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202169 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC202169 protein sequence
Red=Cloning site Green=Tags(s) MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC VIS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004117 |
RefSeq Size | 964 |
RefSeq ORF | 219 |
Synonyms | GNGT11 |
Locus ID | 2791 |
Cytogenetics | 7q21.3 |
Summary | This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418201 | GNG11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418201 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 11 (GNG11) |
CNY 3080.00 |
|
TP302169 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 11 (GNG11), 20 µg |
CNY 2900.00 |