Calpastatin (CAST) (NM_001042444) Human Recombinant Protein
CAT＃: TP302168
Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg
View other "Calpastatin" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
热销推荐
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202168 protein sequence
Red=Cloning site Green=Tags(s) MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGG ESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPE VSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKT EKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAK EEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK TEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEK AKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFE DAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKA EHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNT AKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 71.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035909 |
| Locus ID | 831 |
| UniProt ID | P20810 |
| Refseq Size | 4366 |
| Cytogenetics | 5q15 |
| Refseq ORF | 2001 |
| Synonyms | BS-17; PLACK |
| Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
CNY 4840.00 |
|
| LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
CNY 4840.00 |
|
| LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
CNY 3080.00 |
|
| LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
CNY 4840.00 |
|
| PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
CNY 19520.00 |
|
| PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
CNY 19520.00 |
|
| PH322278 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) |
CNY 14250.00 |
|
| TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Calpastatin产品
