Calpastatin (CAST) (NM_001042444) Human Mass Spec Standard
CAT#: PH302168
CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909)
View other "Calpastatin" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202168 |
Predicted MW | 71.9 kDa |
Protein Sequence |
>RC202168 protein sequence
Red=Cloning site Green=Tags(s) MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGG ESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPE VSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKT EKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAK EEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK TEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEK AKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFE DAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKA EHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNT AKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035909 |
RefSeq Size | 4366 |
RefSeq ORF | 2001 |
Synonyms | BS-17; PLACK |
Locus ID | 831 |
Cytogenetics | 5q15 |
Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
CNY 4840.00 |
|
LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
CNY 4840.00 |
|
LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
CNY 3080.00 |
|
LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
CNY 4840.00 |
|
PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
CNY 19520.00 |
|
PH322278 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) |
CNY 14250.00 |
|
TP302168 | Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg |
CNY 2900.00 |
|
TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Calpastatin产品