REEP6 (NM_138393) Human Recombinant Protein
CAT#: TP302159
Recombinant protein of human receptor accessory protein 6 (REEP6), 20 µg
View other "REEP6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202159 protein sequence
Red=Cloning site Green=Tags(s) MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS IKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVV RPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612402 |
Locus ID | 92840 |
UniProt ID | Q96HR9 |
Refseq Size | 1393 |
Cytogenetics | 19p13.3 |
Refseq ORF | 552 |
Synonyms | C19orf32; DP1L1; REEP6.1; REEP6.2; RP77; TB2L1; Yip2f |
Summary | The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77. [provided by RefSeq, May 2017] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408657 | REEP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408657 | Transient overexpression lysate of receptor accessory protein 6 (REEP6) |
CNY 3080.00 |
|
PH302159 | REEP6 MS Standard C13 and N15-labeled recombinant protein (NP_612402) |
CNY 19520.00 |