REEP6 (NM_138393) Human Mass Spec Standard
CAT#: PH302159
REEP6 MS Standard C13 and N15-labeled recombinant protein (NP_612402)
View other "REEP6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | REEP6 MS Standard C13 and N15-labeled recombinant protein (NP_612402) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202159 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC202159 protein sequence
Red=Cloning site Green=Tags(s) MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS IKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVV RPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612402 |
RefSeq Size | 1393 |
RefSeq ORF | 552 |
Synonyms | C19orf32; DP1L1; REEP6.1; REEP6.2; RP77; TB2L1; Yip2f |
Locus ID | 92840 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77. [provided by RefSeq, May 2017] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408657 | REEP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408657 | Transient overexpression lysate of receptor accessory protein 6 (REEP6) |
CNY 3080.00 |
|
TP302159 | Recombinant protein of human receptor accessory protein 6 (REEP6), 20 µg |
CNY 2900.00 |