EAP30 (SNF8) (NM_007241) Human Recombinant Protein
CAT#: TP302137
Recombinant protein of human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), 20 µg
View other "EAP30" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202137 protein sequence
Red=Cloning site Green=Tags(s) MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009172 |
| Locus ID | 11267 |
| UniProt ID | Q96H20 |
| Refseq Size | 1226 |
| Cytogenetics | 17q21.32 |
| Refseq ORF | 774 |
| Synonyms | Dot3; EAP30; VPS22 |
| Summary | The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
| Protein Families | Transcription Factors |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402117 | SNF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402117 | Transient overexpression lysate of SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8) |
CNY 3080.00 |
|
| PH302137 | SNF8 MS Standard C13 and N15-labeled recombinant protein (NP_009172) |
CNY 19520.00 |
