EAP30 (SNF8) (NM_007241) Human Mass Spec Standard
CAT#: PH302137
SNF8 MS Standard C13 and N15-labeled recombinant protein (NP_009172)
View other "EAP30" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SNF8 MS Standard C13 and N15-labeled recombinant protein (NP_009172) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202137 |
| Predicted MW | 28.9 kDa |
| Protein Sequence |
>RC202137 protein sequence
Red=Cloning site Green=Tags(s) MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009172 |
| RefSeq Size | 1226 |
| RefSeq ORF | 774 |
| Synonyms | Dot3; EAP30; VPS22 |
| Locus ID | 11267 |
| Cytogenetics | 17q21.32 |
| Summary | The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
| Protein Families | Transcription Factors |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402117 | SNF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402117 | Transient overexpression lysate of SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8) |
CNY 3080.00 |
|
| TP302137 | Recombinant protein of human SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) (SNF8), 20 µg |
CNY 2900.00 |
