IL6 (NM_000600) Human Recombinant Protein
CAT#: TP302078
Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202078 protein sequence
Red=Cloning site Green=Tags(s) MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR QM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000591 |
| Locus ID | 3569 |
| UniProt ID | P05231 |
| Refseq Size | 1201 |
| Cytogenetics | 7p15.3 |
| Refseq ORF | 636 |
| Synonyms | BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6 |
| Summary | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Jak-STAT signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prion diseases, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424617 | IL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424617 | Transient overexpression lysate of interleukin 6 (interferon, beta 2) (IL6) |
CNY 3080.00 |
|
| PH302078 | IL6 MS Standard C13 and N15-labeled recombinant protein (NP_000591) |
CNY 19520.00 |
|
| TP701114 | Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6), Val30-End, tag free, secretory expressed in HEK293 cells, 50ug |
CNY 7110.00 |
|
| TP720008 | Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), the mature form (Pro29-Met212) with C-terminal His tag |
CNY 3140.00 |
|
| TP723713 | Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6) |
CNY 4090.00 |
|
| TP723955 | Human IL6 Protein, mFc-His Tag |
CNY 5876.00 |
|
| TP750006 | Recombinant protein of human Interleukin 6(IL-6) produced in E. coli. |
CNY 2040.00 |


