IL6 (NM_000600) Human Tagged ORF Clone
CAT#: RC202078
IL6 (Myc-DDK-tagged)-Human interleukin 6 (interferon, beta 2) (IL6)
ORF Plasmid: tGFP
"NM_000600" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3600.00
CNY 3705.00
Cited in 6 publications. |
CNY 1999.00
CNY 2700.00
CNY 6840.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202078 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACTCCTTCTCCACAAGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGTGTTGCCTG CTGCCTTCCCTGCCCCAGTACCCCCAGGAGAAGATTCCAAAGATGTAGCCGCCCCACACAGACAGCCACT CACCTCTTCAGAACGAATTGACAAACAAATTCGGTACATCCTCGACGGCATCTCAGCCCTGAGAAAGGAG ACATGTAACAAGAGTAACATGTGTGAAAGCAGCAAAGAGGCACTGGCAGAAAACAACCTGAACCTTCCAA AGATGGCTGAAAAAGATGGATGCTTCCAATCTGGATTCAATGAGGAGACTTGCCTGGTGAAAATCATCAC TGGTCTTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGGAACAAGCC AGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAGGCAAAGAATCTAGATGCAA TAACCACCCCTGACCCAACCACAAATGCCAGCCTGCTGACGAAGCTGCAGGCACAGAACCAGTGGCTGCA GGACATGACAACTCATCTCATTCTGCGCAGCTTTAAGGAGTTCCTGCAGTCCAGCCTGAGGGCTCTTCGG CAAATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202078 protein sequence
Red=Cloning site Green=Tags(s) MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR QM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000600 |
ORF Size | 636 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_000600.5 |
RefSeq Size | 1201 bp |
RefSeq ORF | 639 bp |
Locus ID | 3569 |
UniProt ID | P05231 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Jak-STAT signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prion diseases, Toll-like receptor signaling pathway |
MW | 23.7 kDa |
Gene Summary | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). [provided by RefSeq, Aug 2020] |
Citations (6)
The use of this cDNA Clones has been cited in the following citations: |
---|
Interleukin-6 Response of C2C12 Myotubes Stimulated with Lipopolysaccharide and Lipoic Acid
,Wu, PF;Chen, GL;,
J. Interferon Cytokine Res.
,PubMed ID 32176561
[IL6]
|
Rapid generation of gene-targeted EPS-derived mouse models through tetraploid complementation
,Li, H;Zhao, C;Xu, J;Xu, Y;Cheng, C;Liu, Y;Wang, T;Du, Y;Xie, L;Zhao, J;Han, Y;Wang, X;Bai, Y;Deng, H;,
Protein Cell
,PubMed ID 29948855
[IL6]
|
Serine hydroxymethyl transferase 1 stimulates pro-oncogenic cytokine expression through sialic acid to promote ovarian cancer tumor growth and progression
,Gupta, R;Yang, Q;Dogra, SK;Wajapeyee, N;,
Oncogene
,PubMed ID 28288142
[IL6]
|
DNA Methyl Transferase 1 Reduces Expression of SRD5A2 in the Aging Adult Prostate
,Ge, R;Wang, Z;Bechis, SK;Otsetov, AG;Hua, S;Wu, S;Wu, CL;Tabatabaei, S;Olumi, AF;,
Am. J. Pathol.
,PubMed ID 25700986
[IL6]
|
Kaposi sarcoma-associated herpesviral IL6 and human IL6 open reading frames contain miRNA binding sites and are subject to cellular miRNA regulation
,null,
The Journal of pathology
,PubMed ID 21984125
[IL6]
|
SPARC Stimulates Neuronal Differentiation of Medulloblastoma Cells via the Notch1/STAT3 Pathway
,Praveen Bhoopathi, Chandramu Chetty, Ranadheer Dontula, Meena Gujrati, Dzung H. Dinh, Jasti S. Rao, and Sajani S. Lakka,
Cancer Res., Jul 2011; 71: 4908 - 4919.
[IL6]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202078L1 | Lenti ORF clone of Human interleukin 6 (interferon, beta 2) (IL6), Myc-DDK-tagged |
CNY 6000.00 |
|
RC202078L2 | Lenti ORF clone of Human interleukin 6 (interferon, beta 2) (IL6), mGFP tagged |
CNY 5890.00 |
|
RC202078L3 | Lenti ORF clone of Human interleukin 6 (interferon, beta 2) (IL6), Myc-DDK-tagged |
CNY 6000.00 |
|
RC202078L4 | Lenti ORF clone of Human interleukin 6 (interferon, beta 2) (IL6), mGFP tagged |
CNY 6000.00 |
|
RG202078 | IL6 (tGFP-tagged) - Human interleukin 6 (interferon, beta 2) (IL6) |
CNY 5200.00 |
|
SC125236 | IL6 (untagged)-Human interleukin 6 (interferon, beta 2) (IL6) |
CNY 2400.00 |