ASB9 (NM_001031739) Human Recombinant Protein
CAT#: TP301901
Recombinant protein of human ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1, 20 µg
View other "ASB9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201901 protein sequence
Red=Cloning site Green=Tags(s) MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK LVLPEDLKQFLLHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001026909 |
| Locus ID | 140462 |
| UniProt ID | Q96DX5 |
| Refseq Size | 1714 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 882 |
| Summary | This gene encodes a member of the ankyrin repeat and suppressor of cytokine signaling (SOCS) box protein family. Members of this family can interact with the elongin B-C adapter complex via their SOCS box domain and further complex with the cullin and ring box proteins to form E3 ubiquitin ligase complexes. They may function to mediate the substrate-recognition of the E3 ubiquitin ligases. A transcribed pseudogene of this gene has been identified on chromosome 15. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422184 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432774 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422184 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1 |
CNY 3080.00 |
|
| LY432774 | Transient overexpression lysate of ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 3 |
CNY 3080.00 |
|
| PH301901 | ASB9 MS Standard C13 and N15-labeled recombinant protein (NP_001026909) |
CNY 19520.00 |
