ASB9 (NM_001031739) Human Mass Spec Standard
CAT#: PH301901
ASB9 MS Standard C13 and N15-labeled recombinant protein (NP_001026909)
View other "ASB9" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ASB9 MS Standard C13 and N15-labeled recombinant protein (NP_001026909) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201901 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC201901 protein sequence
Red=Cloning site Green=Tags(s) MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK LVLPEDLKQFLLHL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001026909 |
RefSeq Size | 1714 |
RefSeq ORF | 882 |
Locus ID | 140462 |
Cytogenetics | Xp22.2 |
Summary | This gene encodes a member of the ankyrin repeat and suppressor of cytokine signaling (SOCS) box protein family. Members of this family can interact with the elongin B-C adapter complex via their SOCS box domain and further complex with the cullin and ring box proteins to form E3 ubiquitin ligase complexes. They may function to mediate the substrate-recognition of the E3 ubiquitin ligases. A transcribed pseudogene of this gene has been identified on chromosome 15. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422184 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432774 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422184 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1 |
CNY 3080.00 |
|
LY432774 | Transient overexpression lysate of ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 3 |
CNY 3080.00 |
|
TP301901 | Recombinant protein of human ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1, 20 µg |
CNY 2900.00 |