ASB9 (NM_001031739) Human Mass Spec Standard
CAT#: PH301901
ASB9 MS Standard C13 and N15-labeled recombinant protein (NP_001026909)
View other "ASB9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ASB9 MS Standard C13 and N15-labeled recombinant protein (NP_001026909) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201901 |
| Predicted MW | 31.9 kDa |
| Protein Sequence |
>RC201901 protein sequence
Red=Cloning site Green=Tags(s) MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK LVLPEDLKQFLLHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001026909 |
| RefSeq Size | 1714 |
| RefSeq ORF | 882 |
| Locus ID | 140462 |
| Cytogenetics | Xp22.2 |
| Summary | This gene encodes a member of the ankyrin repeat and suppressor of cytokine signaling (SOCS) box protein family. Members of this family can interact with the elongin B-C adapter complex via their SOCS box domain and further complex with the cullin and ring box proteins to form E3 ubiquitin ligase complexes. They may function to mediate the substrate-recognition of the E3 ubiquitin ligases. A transcribed pseudogene of this gene has been identified on chromosome 15. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422184 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432774 | ASB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422184 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1 |
CNY 3080.00 |
|
| LY432774 | Transient overexpression lysate of ankyrin repeat and SOCS box containing 9 (ASB9), transcript variant 3 |
CNY 3080.00 |
|
| TP301901 | Recombinant protein of human ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 1, 20 µg |
CNY 2900.00 |
