TMEM98 (NM_015544) Human Recombinant Protein
CAT＃: TP301829
Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1, 20 µg
View other "TMEM98" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201829 protein sequence
Red=Cloning site Green=Tags(s) METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 25946230) |
| Reference Data | |
| RefSeq | NP_056359 |
| Locus ID | 26022 |
| UniProt ID | Q9Y2Y6 |
| Refseq Size | 1808 |
| Cytogenetics | 17q11.2 |
| Refseq ORF | 678 |
| Synonyms | TADA1 |
| Summary | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014] |
| Protein Families | Transmembrane |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
TMEM98, a novel secretory protein, promotes endothelial cell adhesion as well as vascular smooth muscle cell proliferation and migration
,Li, M;Zhu, H;Hu, X;Gao, F;Hu, X;Cui, Y;Wei, X;Xie, C;Lv, G;Zhao, Y;Gao, Y;,
Can. J. Physiol. Pharmacol.
,PubMed ID 32893666
[TMEM98]
|
|
The Secreted Form of Transmembrane Protein 98 Promotes the Differentiation of T Helper 1 Cells
,Fu, W;Cheng, Y;Zhang, Y;Mo, X;Li, T;Liu, Y;Wang, P;Pan, W;Chen, Y;Xue, Y;Ma, D;Zhang, Y;Han, W;,
J. Interferon Cytokine Res.
,PubMed ID 25946230
[TMEM98]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414489 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422371 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414489 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 1 |
CNY 3080.00 |
|
| LY422371 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
CNY 3080.00 |
|
| PH301829 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359) |
CNY 19520.00 |
|
| PH313633 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_001028676) |
CNY 19520.00 |
|
| TP313633 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 2, 20 µg |
CNY 2900.00 |
