TMEM98 (NM_015544) Human Mass Spec Standard
CAT#: PH301829
TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359)
View other "TMEM98" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201829 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC201829 protein sequence
Red=Cloning site Green=Tags(s) METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056359 |
RefSeq Size | 1808 |
RefSeq ORF | 678 |
Synonyms | TADA1 |
Locus ID | 26022 |
Cytogenetics | 17q11.2 |
Summary | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414489 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422371 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414489 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 1 |
CNY 3080.00 |
|
LY422371 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
CNY 3080.00 |
|
PH313633 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_001028676) |
CNY 19520.00 |
|
TP301829 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP313633 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 2, 20 µg |
CNY 2900.00 |