CD63 (NM_001780) Human Recombinant Protein
CAT#: TP301733
Recombinant protein of human CD63 molecule (CD63), transcript variant 1, 20 µg
View other "CD63" proteins (3)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 3 publications. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC201733 protein sequence Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 25.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001771 | 
| Locus ID | 967 | 
| UniProt ID | P08962 | 
| Refseq Size | 1032 | 
| Cytogenetics | 12q13.2 | 
| Refseq ORF | 714 | 
| Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 | 
| Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Lysosome | 
Citations (3)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Improved isolation of extracellular vesicles by removal of both free proteins and lipoproteins
                                                ,null,
                                                eLife
                                                ,PubMed ID 37252755
                                                [CD63] | 
| L1CAM is not associated with extracellular vesicles in human cerebrospinal fluid or plasma
                                                ,null,
                                                Nature methods
                                                ,PubMed ID 34092791
                                                [CD63] | 
| Framework for rapid comparison of extracellular vesicle isolation methods
                                                ,null,
                                                eLife
                                                ,PubMed ID 34783650
                                                [CD63] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419757 | CD63 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY419757 | Transient overexpression lysate of CD63 molecule (CD63), transcript variant 1 | CNY 3080.00 | |
| PH301733 | CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771) | CNY 19520.00 | 


 
                        

 
        