CD63 (NM_001780) Human Mass Spec Standard
CAT#: PH301733
CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771)
View other "CD63" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201733 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC201733 protein sequence
Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001771 |
| RefSeq Size | 1032 |
| RefSeq ORF | 714 |
| Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 |
| Locus ID | 967 |
| Cytogenetics | 12q13.2 |
| Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419757 | CD63 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419757 | Transient overexpression lysate of CD63 molecule (CD63), transcript variant 1 |
CNY 3080.00 |
|
| TP301733 | Recombinant protein of human CD63 molecule (CD63), transcript variant 1, 20 µg |
CNY 2900.00 |


