NTF2 (NUTF2) (NM_005796) Human Recombinant Protein
CAT#: TP301728
Recombinant protein of human nuclear transport factor 2 (NUTF2), 20 µg
View other "NTF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201728 protein sequence
Red=Cloning site Green=Tags(s) MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 14.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005787 |
| Locus ID | 10204 |
| UniProt ID | P61970 |
| Refseq Size | 894 |
| Cytogenetics | 16q22.1 |
| Refseq ORF | 381 |
| Synonyms | NTF-2; NTF2; PP15 |
| Summary | This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. [provided by RefSeq, Apr 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417082 | NUTF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417082 | Transient overexpression lysate of nuclear transport factor 2 (NUTF2) |
CNY 3080.00 |
|
| PH301728 | NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787) |
CNY 19520.00 |
