NTF2 (NUTF2) (NM_005796) Human Mass Spec Standard
CAT#: PH301728
NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787)
View other "NTF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201728 |
| Predicted MW | 14.5 kDa |
| Protein Sequence |
>RC201728 protein sequence
Red=Cloning site Green=Tags(s) MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA QDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005787 |
| RefSeq Size | 894 |
| RefSeq ORF | 381 |
| Synonyms | NTF-2; NTF2; PP15 |
| Locus ID | 10204 |
| Cytogenetics | 16q22.1 |
| Summary | This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. [provided by RefSeq, Apr 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417082 | NUTF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417082 | Transient overexpression lysate of nuclear transport factor 2 (NUTF2) |
CNY 3080.00 |
|
| TP301728 | Recombinant protein of human nuclear transport factor 2 (NUTF2), 20 µg |
CNY 2900.00 |
