TCTP (TPT1) (NM_003295) Human Recombinant Protein
CAT#: TP301664
Recombinant protein of human tumor protein, translationally-controlled 1 (TPT1), 20 µg
View other "TCTP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201664 protein sequence
Red=Cloning site Green=Tags(s) MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.4 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003286 |
| Locus ID | 7178 |
| UniProt ID | P13693 |
| Refseq Size | 4649 |
| Cytogenetics | 13q14.13 |
| Refseq ORF | 516 |
| Synonyms | HRF; p02; p23; TCTP |
| Summary | This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent conditions. The encoded protein is involved in a variety of cellular pathways, including apoptosis, protein synthesis and cell division. It binds to and stabilizes microtubules, and removal of this protein through phosphorylation is required for progression through mitotic and meiotic cell divisions. This gene is known to play a role in carcinogenesis, and is upregulated in some cancer cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017] |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Fortilin interacts with TGF-β1 and prevents TGF-β receptor activation
,null,
Communications Biology
,PubMed ID 35197550
[TPT1]
|
|
Orchestration of myeloid-derived suppressor cells in the tumor microenvironment by ubiquitous cellular protein TCTP released by tumor cells.
,null,
Nature immunology
,PubMed ID 34239121
[TPT1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401136 | TPT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401136 | Transient overexpression lysate of tumor protein, translationally-controlled 1 (TPT1) |
CNY 3080.00 |
|
| PH301664 | TPT1 MS Standard C13 and N15-labeled recombinant protein (NP_003286) |
CNY 19520.00 |


