S100P (NM_005980) Human Recombinant Protein
CAT#: TP301533
Recombinant protein of human S100 calcium binding protein P (S100P), 20 µg
View other "S100P" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC201533 protein sequence 
Red=Cloning site Green=Tags(s) MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD FSEFIVFVAAITSACHKYFEKAGLK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 10.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005971 | 
| Locus ID | 6286 | 
| UniProt ID | P25815 | 
| Refseq Size | 510 | 
| Cytogenetics | 4p16.1 | 
| Refseq ORF | 285 | 
| Synonyms | MIG9 | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401809 | S100P HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401809 | Transient overexpression lysate of S100 calcium binding protein P (S100P) | 
                                                     CNY 3080.00  | 
                                            |
| PH301533 | S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) | 
                                                     CNY 19520.00  | 
                                            |
| TP720231 | Recombinant protein of human S100 calcium binding protein P (S100P) | 
                                                     CNY 1800.00  | 
                                            
