S100P (NM_005980) Human Mass Spec Standard
CAT#: PH301533
S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971)
View other "S100P" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC201533 | 
| Predicted MW | 10.4 kDa | 
| Protein Sequence | 
                 >RC201533 protein sequence 
Red=Cloning site Green=Tags(s) MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD FSEFIVFVAAITSACHKYFEKAGLK myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_005971 | 
| RefSeq Size | 510 | 
| RefSeq ORF | 285 | 
| Synonyms | MIG9 | 
| Locus ID | 6286 | 
| Cytogenetics | 4p16.1 | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401809 | S100P HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401809 | Transient overexpression lysate of S100 calcium binding protein P (S100P) | 
                                                     CNY 3080.00  | 
                                            |
| TP301533 | Recombinant protein of human S100 calcium binding protein P (S100P), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP720231 | Recombinant protein of human S100 calcium binding protein P (S100P) | 
                                                     CNY 1800.00  | 
                                            
