ERLEC1 (NM_015701) Human Recombinant Protein
CAT#: TP301486
Recombinant protein of human chromosome 2 open reading frame 30 (C2orf30), transcript variant 1, 20 µg
View other "ERLEC1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201486 protein sequence
Red=Cloning site Green=Tags(s) MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056516 |
Locus ID | 27248 |
UniProt ID | Q96DZ1 |
Refseq Size | 2605 |
Cytogenetics | 2p16.2 |
Refseq ORF | 1449 |
Synonyms | C2orf30; CIM; CL24936; CL25084; HEL117; XTP3-B; XTP3TPB |
Summary | This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. [provided by RefSeq, Aug 2011] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414394 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426779 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414394 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 1 |
CNY 3080.00 |
|
LY426779 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 |
CNY 3080.00 |
|
PH301486 | ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516) |
CNY 19520.00 |