ERLEC1 (NM_015701) Human Mass Spec Standard
CAT#: PH301486
ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516)
View other "ERLEC1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ERLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_056516) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201486 |
| Predicted MW | 54.9 kDa |
| Protein Sequence |
>RC201486 protein sequence
Red=Cloning site Green=Tags(s) MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMT TAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKET GQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSST VMYICHPESKHEILSVAEVTTCEYEVVILTPLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQ EEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVG WWKYEFCYGKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLSLPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056516 |
| RefSeq Size | 2605 |
| RefSeq ORF | 1449 |
| Synonyms | C2orf30; CIM; CL24936; CL25084; HEL117; XTP3-B; XTP3TPB |
| Locus ID | 27248 |
| Cytogenetics | 2p16.2 |
| Summary | This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. [provided by RefSeq, Aug 2011] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414394 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426779 | ERLEC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414394 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 1 |
CNY 3080.00 |
|
| LY426779 | Transient overexpression lysate of endoplasmic reticulum lectin 1 (ERLEC1), transcript variant 2 |
CNY 3080.00 |
|
| TP301486 | Recombinant protein of human chromosome 2 open reading frame 30 (C2orf30), transcript variant 1, 20 µg |
CNY 2900.00 |
