BCS1L (NM_004328) Human Recombinant Protein
CAT#: TP301195
Recombinant protein of human BCS1-like (yeast) (BCS1L), transcript variant 1, 20 µg
View other "BCS1L" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201195 protein sequence
Red=Cloning site Green=Tags(s) MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH STRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTAL GTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL LEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004319 |
| Locus ID | 617 |
| UniProt ID | Q9Y276 |
| Refseq Size | 1663 |
| Cytogenetics | 2q35 |
| Refseq ORF | 1257 |
| Synonyms | BCS; BCS1; BJS; FLNMS; GRACILE; h-BCS; h-BCS1; Hs.6719; MC3DN1; PTD |
| Summary | This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Several alternatively spliced transcripts encoding two different isoforms have been described. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418060 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421566 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418060 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), transcript variant 1 |
CNY 3080.00 |
|
| LY421566 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4840.00 |
|
| PH301195 | BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_004319) |
CNY 19520.00 |
|
| PH313712 | BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335) |
CNY 19520.00 |
|
| TP313712 | Recombinant protein of human BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
