BCS1L (NM_001079866) Human Mass Spec Standard
CAT#: PH313712
BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335)
View other "BCS1L" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213712 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC213712 protein sequence
Red=Cloning site Green=Tags(s) MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH STRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTAL GTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL LEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001073335 |
RefSeq Size | 1454 |
RefSeq ORF | 1257 |
Synonyms | BCS; BCS1; BJS; FLNMS; GRACILE; h-BCS; h-BCS1; Hs.6719; MC3DN1; PTD |
Locus ID | 617 |
Cytogenetics | 2q35 |
Summary | This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Several alternatively spliced transcripts encoding two different isoforms have been described. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418060 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421566 | BCS1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY418060 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), transcript variant 1 |
CNY 3080.00 |
|
LY421566 | Transient overexpression lysate of BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4840.00 |
|
PH301195 | BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_004319) |
CNY 19520.00 |
|
TP301195 | Recombinant protein of human BCS1-like (yeast) (BCS1L), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP313712 | Recombinant protein of human BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |