ProSAAS (PCSK1N) (NM_013271) Human Recombinant Protein
CAT#: TP301065
Purified recombinant protein of Homo sapiens proprotein convertase subtilisin/kexin type 1 inhibitor (PCSK1N), 20 µg
View other "ProSAAS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201065 representing NM_013271
Red=Cloning site Green=Tags(s) MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAG AVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARAL LRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSE GVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037403 |
| Locus ID | 27344 |
| UniProt ID | Q9UHG2 |
| Refseq Size | 990 |
| Cytogenetics | Xp11.23 |
| Refseq ORF | 780 |
| Synonyms | BigLEN; PEN; PROSAAS; SAAS; SCG8; SgVIII |
| Summary | The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415696 | PCSK1N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415696 | Transient overexpression lysate of proprotein convertase subtilisin/kexin type 1 inhibitor (PCSK1N) |
CNY 3080.00 |
|
| PH301065 | PCSK1N MS Standard C13 and N15-labeled recombinant protein (NP_037403) |
CNY 14250.00 |
其它ProSAAS产品
