ProSAAS (PCSK1N) (NM_013271) Human Mass Spec Standard
CAT#: PH301065
PCSK1N MS Standard C13 and N15-labeled recombinant protein (NP_037403)
View other "ProSAAS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | PCSK1N MS Standard C13 and N15-labeled recombinant protein (NP_037403) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201065 |
| Predicted MW | 27.37 kDa |
| Protein Sequence |
>RC201065 representing NM_013271
Red=Cloning site Green=Tags(s) MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAG AVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARAL LRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSE GVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037403 |
| RefSeq Size | 990 |
| RefSeq ORF | 780 |
| Synonyms | BigLEN; PEN; PROSAAS; SAAS; SCG8; SgVIII |
| Locus ID | 27344 |
| Cytogenetics | Xp11.23 |
| Summary | The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415696 | PCSK1N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415696 | Transient overexpression lysate of proprotein convertase subtilisin/kexin type 1 inhibitor (PCSK1N) |
CNY 3080.00 |
|
| TP301065 | Purified recombinant protein of Homo sapiens proprotein convertase subtilisin/kexin type 1 inhibitor (PCSK1N), 20 µg |
CNY 2900.00 |
其它ProSAAS产品
