SF3B5 (NM_031287) Human Recombinant Protein
CAT#: TP300977
Recombinant protein of human splicing factor 3b, subunit 5, 10kDa (SF3B5), 20 µg
View other "SF3B5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200977 protein sequence
Red=Cloning site Green=Tags(s) MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME KMLQPCGPPADKPEEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112577 |
Locus ID | 83443 |
UniProt ID | Q9BWJ5 |
Refseq Size | 786 |
Cytogenetics | 6q24.2 |
Refseq ORF | 258 |
Synonyms | SF3b10; Ysf3 |
Summary | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410578 | SF3B5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410578 | Transient overexpression lysate of splicing factor 3b, subunit 5, 10kDa (SF3B5) |
CNY 3080.00 |
|
PH300977 | SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577) |
CNY 19520.00 |