SF3B5 (NM_031287) Human Mass Spec Standard
CAT#: PH300977
SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577)
View other "SF3B5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200977 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC200977 protein sequence
Red=Cloning site Green=Tags(s) MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME KMLQPCGPPADKPEEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112577 |
RefSeq Size | 786 |
RefSeq ORF | 258 |
Synonyms | SF3b10; Ysf3 |
Locus ID | 83443 |
Cytogenetics | 6q24.2 |
Summary | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410578 | SF3B5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410578 | Transient overexpression lysate of splicing factor 3b, subunit 5, 10kDa (SF3B5) |
CNY 3080.00 |
|
TP300977 | Recombinant protein of human splicing factor 3b, subunit 5, 10kDa (SF3B5), 20 µg |
CNY 2900.00 |