SF3B5 (NM_031287) Human Mass Spec Standard
CAT#: PH300977
SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577)
View other "SF3B5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200977 |
| Predicted MW | 10.1 kDa |
| Protein Sequence |
>RC200977 protein sequence
Red=Cloning site Green=Tags(s) MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME KMLQPCGPPADKPEEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112577 |
| RefSeq Size | 786 |
| RefSeq ORF | 258 |
| Synonyms | SF3b10; Ysf3 |
| Locus ID | 83443 |
| Cytogenetics | 6q24.2 |
| Summary | Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410578 | SF3B5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410578 | Transient overexpression lysate of splicing factor 3b, subunit 5, 10kDa (SF3B5) |
CNY 3080.00 |
|
| TP300977 | Recombinant protein of human splicing factor 3b, subunit 5, 10kDa (SF3B5), 20 µg |
CNY 2900.00 |
