SDF2 (NM_006923) Human Recombinant Protein
CAT#: TP300939
Recombinant protein of human stromal cell-derived factor 2 (SDF2), 20 µg
View other "SDF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200939 protein sequence
Red=Cloning site Green=Tags(s) MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008854 |
| Locus ID | 6388 |
| UniProt ID | Q99470 |
| Refseq Size | 1565 |
| Cytogenetics | 17q11.2 |
| Refseq ORF | 633 |
| Summary | The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416324 | SDF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416324 | Transient overexpression lysate of stromal cell-derived factor 2 (SDF2) |
CNY 3080.00 |
|
| PH300939 | SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854) |
CNY 19520.00 |
