SDF2 (NM_006923) Human Mass Spec Standard
CAT#: PH300939
SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854)
View other "SDF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200939 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC200939 protein sequence
Red=Cloning site Green=Tags(s) MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008854 |
| RefSeq Size | 1565 |
| RefSeq ORF | 633 |
| Locus ID | 6388 |
| Cytogenetics | 17q11.2 |
| Summary | The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416324 | SDF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416324 | Transient overexpression lysate of stromal cell-derived factor 2 (SDF2) |
CNY 3080.00 |
|
| TP300939 | Recombinant protein of human stromal cell-derived factor 2 (SDF2), 20 µg |
CNY 2900.00 |
