CYBC1 (NM_001033046) Human Recombinant Protein
CAT＃: TP300883
Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg
View other "CYBC1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200883 protein sequence
Red=Cloning site Green=Tags(s) MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001028218 |
| Locus ID | 79415 |
| UniProt ID | Q9BQA9 |
| Refseq Size | 2167 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 561 |
| Synonyms | C17orf62; CGD5; Eros |
| Summary | Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420251 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420252 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422350 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420251 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 |
CNY 3080.00 |
|
| LY420252 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 |
CNY 3080.00 |
|
| LY422350 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 |
CNY 3080.00 |
|
| PH300883 | C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218) |
CNY 19520.00 |
