CYBC1 (NM_001033046) Human Mass Spec Standard
CAT#: PH300883
C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218)
View other "CYBC1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200883 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC200883 protein sequence
Red=Cloning site Green=Tags(s) MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001028218 |
RefSeq Size | 2167 |
RefSeq ORF | 561 |
Synonyms | C17orf62; CGD5; Eros |
Locus ID | 79415 |
Cytogenetics | 17q25.3 |
Summary | Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420251 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420252 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422350 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420251 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 |
CNY 3080.00 |
|
LY420252 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 |
CNY 3080.00 |
|
LY422350 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 |
CNY 3080.00 |
|
TP300883 | Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg |
CNY 2900.00 |