CYBC1 (NM_001033046) Human Mass Spec Standard
CAT＃: PH300883
C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218)
View other "CYBC1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200883 |
| Predicted MW | 20.8 kDa |
| Protein Sequence |
>RC200883 protein sequence
Red=Cloning site Green=Tags(s) MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001028218 |
| RefSeq Size | 2167 |
| RefSeq ORF | 561 |
| Synonyms | C17orf62; CGD5; Eros |
| Locus ID | 79415 |
| Cytogenetics | 17q25.3 |
| Summary | Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420251 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420252 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422350 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420251 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 |
CNY 3080.00 |
|
| LY420252 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 |
CNY 3080.00 |
|
| LY422350 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 |
CNY 3080.00 |
|
| TP300883 | Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg |
CNY 2900.00 |
