MIS12 (NM_024039) Human Recombinant Protein
CAT#: TP300789
Recombinant protein of human MIS12, MIND kinetochore complex component, homolog (yeast) (MIS12), 20 µg
View other "MIS12" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200789 protein sequence
Red=Cloning site Green=Tags(s) MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076944 |
Locus ID | 79003 |
UniProt ID | Q9H081 |
Refseq Size | 2543 |
Cytogenetics | 17p13.2 |
Refseq ORF | 615 |
Synonyms | 2510025F08Rik; hMis12; KNTC2AP; MTW1 |
Summary | Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis (PubMed:12515822, PubMed:15502821, PubMed:16585270). Essential for proper kinetochore microtubule attachments (PubMed:23891108).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411415 | MIS12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411415 | Transient overexpression lysate of MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) |
CNY 3080.00 |
|
PH300789 | MIS12 MS Standard C13 and N15-labeled recombinant protein (NP_076944) |
CNY 19520.00 |