MCG10 (PCBP4) (NM_033008) Human Recombinant Protein
CAT#: TP300749
Recombinant protein of human poly(rC) binding protein 4 (PCBP4), transcript variant 3, 20 µg
View other "MCG10" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200749 protein sequence
Red=Cloning site Green=Tags(s) MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTA AVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTP AEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ AEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPY AISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_127501 |
Locus ID | 57060 |
UniProt ID | P57723 |
Refseq Size | 2040 |
Cytogenetics | 3p21.2 |
Refseq ORF | 1209 |
Synonyms | CBP; LIP4; MCG10 |
Summary | This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403218 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409760 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429839 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403218 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 3 |
CNY 3080.00 |
|
LY409760 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 |
CNY 3080.00 |
|
LY429839 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 |
CNY 3080.00 |
|
PH300749 | PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127501) |
CNY 19520.00 |
|
PH324895 | PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127503) |
CNY 14250.00 |
|
TP324895 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 4 (PCBP4), transcript variant 4, 20 µg |
CNY 2900.00 |