MCG10 (PCBP4) (NM_033008) Human Mass Spec Standard
CAT#: PH300749
PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127501)
View other "MCG10" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127501) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200749 |
| Predicted MW | 41.5 kDa |
| Protein Sequence |
>RC200749 protein sequence
Red=Cloning site Green=Tags(s) MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTA AVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTP AEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ AEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPY AISLSNFIGLKPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_127501 |
| RefSeq Size | 2040 |
| RefSeq ORF | 1209 |
| Synonyms | CBP; LIP4; MCG10 |
| Locus ID | 57060 |
| Cytogenetics | 3p21.2 |
| Summary | This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403218 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409760 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429839 | PCBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403218 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 3 |
CNY 3080.00 |
|
| LY409760 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 |
CNY 3080.00 |
|
| LY429839 | Transient overexpression lysate of poly(rC) binding protein 4 (PCBP4), transcript variant 4 |
CNY 3080.00 |
|
| PH324895 | PCBP4 MS Standard C13 and N15-labeled recombinant protein (NP_127503) |
CNY 14250.00 |
|
| TP300749 | Recombinant protein of human poly(rC) binding protein 4 (PCBP4), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP324895 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 4 (PCBP4), transcript variant 4, 20 µg |
CNY 2900.00 |
