PRPS1 (NM_002764) Human Recombinant Protein
CAT#: TP300698
Recombinant protein of human phosphoribosyl pyrophosphate synthetase 1 (PRPS1), 20 µg
View other "PRPS1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200698 protein sequence
Red=Cloning site Green=Tags(s) MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMEL LIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDI PVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGD VKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDK MKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002755 |
| Locus ID | 5631 |
| UniProt ID | P60891 |
| Refseq Size | 2156 |
| Cytogenetics | Xq22.3 |
| Refseq ORF | 954 |
| Synonyms | ARTS; CMTX5; DFN2; DFNX1; PPRibP; PRS-I; PRSI |
| Summary | This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400979 | PRPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400979 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 1 (PRPS1) |
CNY 3080.00 |
|
| PH300698 | PRPS1 MS Standard C13 and N15-labeled recombinant protein (NP_002755) |
CNY 19520.00 |
