PRPS1 (NM_002764) Human Mass Spec Standard
CAT#: PH300698
PRPS1 MS Standard C13 and N15-labeled recombinant protein (NP_002755)
View other "PRPS1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PRPS1 MS Standard C13 and N15-labeled recombinant protein (NP_002755) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200698 |
| Predicted MW | 34.8 kDa |
| Protein Sequence |
>RC200698 protein sequence
Red=Cloning site Green=Tags(s) MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMEL LIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDI PVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGD VKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDK MKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002755 |
| RefSeq Size | 2156 |
| RefSeq ORF | 954 |
| Synonyms | ARTS; CMTX5; DFN2; DFNX1; PPRibP; PRS-I; PRSI |
| Locus ID | 5631 |
| Cytogenetics | Xq22.3 |
| Summary | This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400979 | PRPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400979 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 1 (PRPS1) |
CNY 3080.00 |
|
| TP300698 | Recombinant protein of human phosphoribosyl pyrophosphate synthetase 1 (PRPS1), 20 µg |
CNY 2900.00 |
