PCLAF (NM_014736) Human Recombinant Protein
CAT#: TP300694
Recombinant protein of human KIAA0101 (KIAA0101), transcript variant 1, 20 µg
View other "PCLAF" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200694 protein sequence
Red=Cloning site Green=Tags(s) MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055551 |
Locus ID | 9768 |
UniProt ID | Q15004 |
Refseq Size | 1515 |
Cytogenetics | 15q22.31 |
Refseq ORF | 333 |
Synonyms | KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15 |
Summary | PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415072 | KIAA0101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415072 | Transient overexpression lysate of KIAA0101 (KIAA0101), transcript variant 1 |
CNY 3080.00 |
|
PH300694 | KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551) |
CNY 19520.00 |
|
TP761509 | Purified recombinant protein of Human KIAA0101 (KIAA0101), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |