PCLAF (NM_014736) Human Mass Spec Standard
CAT#: PH300694
KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551)
View other "PCLAF" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200694 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC200694 protein sequence
Red=Cloning site Green=Tags(s) MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055551 |
RefSeq Size | 1515 |
RefSeq ORF | 333 |
Synonyms | KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15 |
Locus ID | 9768 |
Cytogenetics | 15q22.31 |
Summary | PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415072 | KIAA0101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415072 | Transient overexpression lysate of KIAA0101 (KIAA0101), transcript variant 1 |
CNY 3080.00 |
|
TP300694 | Recombinant protein of human KIAA0101 (KIAA0101), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP761509 | Purified recombinant protein of Human KIAA0101 (KIAA0101), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |